Home Page
Click once!

DeCypher Results for: ClustalW Multiple Alignment

View dendrogram

Xdkk-1         --------------------------------------------------------MGSN
humanDKK1      -------------------------------------------------MMALGAAGATR
humanDKK2      -------------------------------------------------MAALMRSKDSS
HumanDKK3      MQRLGATLLCLLLAAAVPTAPAPAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMED
HumanDKK4      ------------------------------------------------------------
                                                                            

Xdkk-1         MFPVPLIVFWGF--ILDGALGFVMMTNSN-----SIKNVPAAPAGQPIGY--YPV----S
humanDKK1      VFVAMVAAALGGHPLLGVSATLNSVLNSN-----AIKNLPP-PLGGAAGHPGSAV----S
humanDKK2      CCLLLLAAVLMV---ES-SQIGSSRAKLN-----SIKSSLGGETPGQAAN--RSA----G
HumanDKK3      TQHKLRSAVEEMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITN
HumanDKK4      ----MVAAVLLGLSWLC-SPLGALVLDFN-----NIRSSAD-------LH---------G
                      .          :         *       ..                     .

Xdkk-1         VSPDSLYDIANKYQPLDA---YPLYSCTEDDDCALDEFCHSSRNGNSL---VCLACRKRR
humanDKK1      AAPGILYPGGNKYQTIDN---YQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRR
humanDKK2      MYQGLAFGGSKKGKNLG-----QAYPCSSDKECEVGRYCHSPHQGSSA----CMVCRRKK
HumanDKK3      NQTGQMVFSETVITSVGDEEGRRSHECIIDEDCGPSMYC-QFASFQYT----CQPCRGQR
HumanDKK4      ARKGS--------------------QCLSDTDCNTRKFCLQPRDEKPF----CATCRGLR
                  .                      *  * :*    :* .           *  **  :

Xdkk-1         KRCLRDAMCCTGNYCSNGICVPVEQDQER------FQHQ-GYLEETILENYNNADHATMD
humanDKK1      KRCMRHAMCCPGNYCKNGICVSSDQNH--------FR---GEIEETITESFGN-DHSTLD
humanDKK2      KRCHRDGMCCPSTRCNNGICIPVTESIL-------TPHI-PALDGTRHRDRNHGHYSNHD
HumanDKK3      MLCTRDSECCGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLP
HumanDKK4      RRCQRDAMCCPGTLCVNDVCTTMEDATPI------LERQLDEQDGTHAEGTTG--HPVQE
                 * *.. ** .  *  . *                         :  ..      .

Xdkk-1         THSKLTTSP-SGMQPFKGRD--GDVCLRSTDCAPGLCCARHF--WSKICKPVL-----DE
humanDKK1      GYSRRTTLS-SKMYHTKGQE--GSVCLRSSDCASGLCCARHF--WSKICKPVL-----KE
humanDKK2      LGWQNLGRPHTKMSHIKGHE--GDPCLRSSDCIEGFCCARHF--WTKICKPVL-----HQ
HumanDKK3      VEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQD
HumanDKK4      NQPKRKPSI-KKSQGRKGQE--GESCLRTFDCGPGLCCARHF--WTKICKPVL-----LE
                  .      .        :   . .*    *  *: *  *      :***.:      :

Xdkk-1         GQVCTKHRRKGS----HGLEIFQRCHCGAGLSCRLQKGEFTTVPKTSRLHTCQRH---
humanDKK1      GQVCTKHRRKGS----HGLEIFQRCYCGEGLSCRIQK-DHHQASNSSRLHTCQRH---
humanDKK2      GEVCTKQRKKGS----HGLEIFQRCDCAKGLSCKVWK--DATYSSKARLHVCQKI---
HumanDKK3      GEILLPREVPDEYEVGSFMEEVRQELEDLERSLTEEMALGEPAAAAAALLGGEEI---
HumanDKK4      GQVCSRRGHKDTA---QAPEIFQRCDCGPGLLCRSQL---TSNRQHARLRVCQKIEKL
               *::   :   .        * .::                      : *   :.


Dendrogram (to view, enable Java on your browser)

Return to top

Dendrogram Source Data

( ( ( Xdkk-1:0.24881, humanDKK1:0.22996) :0.09383, humanDKK2:0.32316) :0.02361, HumanDKK3:0.47568, HumanDKK4:0.32789);

Job Details

Return to top
[BEGIN JOB STATUS]



[BEGIN CLUSTALW TIME] Thu Jul 26 14:41:11 2001
[END CLUSTALW TIME] Thu Jul 26 14:41:13 2001
[VERSION] 7.0.0.593
[SEARCH ID] CGI_2120aws205efd.tl6
[EOL] CRLF
[COMMENT] /Comment=ClustalW Multiple Alignment
[COMMENT] /CGI_Ver=7.0.0.104
[ALGORITHM] CW
[QUERY FORMAT] FASTA/PEARSON
[QUERY TYPE] AA
[QUERY SEARCH] 1
[QUERY PATH] d:\decypher\query
[QUERY SET] CGI_2120aws205efd.seq
[TARGET TYPE] AA
[RESULT PATH] d:\decypher\output
[OUTPUT FORMAT] TEXT PERCENTAGE EXTRACTALIGNED



[CLUSTALW RESULTS]


 CLUSTAL W (1.7) Multiple Sequence Alignments



Sequence type explicitly set to Protein
Sequence format is Pearson
Sequence 1: Xdkk-1          259 aa
Sequence 2: humanDKK1       266 aa
Sequence 3: humanDKK2       259 aa
Sequence 4: HumanDKK3       350 aa
Sequence 5: HumanDKK4       224 aa
Start of Pairwise alignments
Aligning...
Sequences (1:2) Aligned. Score:  52
Sequences (1:3) Aligned. Score:  31
Sequences (1:4) Aligned. Score:  14
Sequences (1:5) Aligned. Score:  33
Sequences (2:3) Aligned. Score:  37
Sequences (2:4) Aligned. Score:  18
Sequences (2:5) Aligned. Score:  30
Sequences (3:4) Aligned. Score:  18
Sequences (3:5) Aligned. Score:  32
Sequences (4:5) Aligned. Score:  19
Guide tree        file created:   [d:\decypher\query\CGI_2120aws205efd.dnd]
Start of Multiple Alignment
There are 4 groups
Aligning...
Group 1: Sequences:   2      Score:2128
Group 2:                     Delayed
Group 3:                     Delayed
Group 4:                     Delayed
Sequence:3     Score:1890
Sequence:5     Score:1582
Sequence:4     Score:1893
Alignment Score 3557
CLUSTAL-Alignment file created  [d:\decypher\output\cgi_2120aws205efd.out.aln]



[JOB MESSAGES]

Message=CGI_2120aws205efd.tl6 had no errors.



[END JOB STATUS]

Return to Request Page
For assistance contact
brutlag@stanford.edu